Tirzepatide
Tirzepatide
This batch of Tirzepatide Peptide has been third-party lab-tested and verified for quality.
Contents: Tirzepatide (Dual GIP and GLP-1 Receptor Agonist)
Form: Powder
Purity: 99.3%
Couldn't load pickup availability
Free Reconstitution Solution automatically added to your cart with each order.
This product is Made, Tested & Shipped From United States.
Shipping & Delivery
We are committed to delivering fast, reliable, and transparent shipping for all orders. Please review our policy below for details on delivery times, tracking, and what to expect with every purchase.
View Full Shipping Policy
Verified+

Tirzepatide Peptide
Tirzepatide is a synthetic 39-amino-acid peptide that functions as a dual agonist of the glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptors. It is designed to mimic the actions of endogenous incretin hormones, which play a key role in glucose metabolism, energy balance, and appetite regulation. Tirzepatide is being investigated in metabolic and endocrine research as a next-generation incretin-based compound for glycemic control and body-weight modulation.
Overview
Tirzepatide combines GIP and GLP-1 receptor activity within a single molecule, producing additive or synergistic effects on insulin secretion, glucagon suppression, and satiety regulation. Its design includes a C20 fatty diacid moiety attached via a linker at Lys20, allowing reversible albumin binding and prolonged circulation time.
In preclinical and clinical research, Tirzepatide has demonstrated dose-dependent reductions in blood glucose and body weight, along with favorable effects on lipid metabolism and insulin sensitivity. It is of interest for studies exploring integrated incretin signaling, metabolic efficiency, and energy homeostasis.
Chemical Makeup
- Molecular Formula: C225H348N48O68
- Molecular Weight: 4813.5 g/mol
- Amino Acid Sequence: YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ (modified GIP/GLP-1 hybrid sequence with C20 fatty diacid side chain at Lys20)
- Compound Class: Dual GIP/GLP-1 receptor agonist
- Form: Lyophilized peptide
- Purity: ≥99% (per COA)
- Sizes Available: 5mg, 10mg, 15mg, 20mg, 30mg vials
Research and Clinical Studies
Glucose Homeostasis
Tirzepatide enhances glucose-dependent insulin secretion while suppressing glucagon release, resulting in improved glycemic profiles. Animal and human studies have shown significant HbA1c reduction compared with selective GLP-1 agonists.
Body-Weight Regulation
Research demonstrates that Tirzepatide influences hypothalamic appetite pathways through dual incretin receptor signaling, leading to reduced energy intake and body-weight loss in preclinical and clinical models.
Insulin Sensitivity and Lipid Metabolism
Tirzepatide has been shown to increase insulin sensitivity in hepatic and peripheral tissues, reduce plasma triglycerides, and improve overall lipid handling in metabolic disease models.
Cardiometabolic and Hepatic Function
Studies indicate that dual incretin activation may reduce systemic inflammation, improve endothelial function, and support hepatic lipid clearance, suggesting cardioprotective and hepatoprotective potential.
Mechanism and Pharmacokinetics
The albumin-binding C20 acyl chain provides an extended elimination half-life (~5 days in primate models), supporting once-weekly administration in long-term metabolic research protocols.
Tirzepatide peptide is available for research and laboratory purposes only. Not for human consumption.
References
- Frias JP, et al. Tirzepatide versus semaglutide in type 2 diabetes. N Engl J Med. 2021;385(6):503–515. https://pubmed.ncbi.nlm.nih.gov/34170647/
- Coskun T, et al. LY3298176, a novel dual GIP and GLP-1 receptor agonist for the treatment of type 2 diabetes. Sci Transl Med. 2018;10(467):eaao6119. https://pubmed.ncbi.nlm.nih.gov/30404864/
- Willard FS, et al. Tirzepatide: discovery and preclinical profile. Cell Metab. 2020;31(3):564–574.e5. https://pubmed.ncbi.nlm.nih.gov/32084394/
- Heise T, et al. Pharmacokinetics and pharmacodynamics of the dual GIP/GLP-1 receptor agonist Tirzepatide. Clin Pharmacokinet. 2022;61(3):359–372. https://pubmed.ncbi.nlm.nih.gov/34694692/
- Drucker DJ. Mechanisms of incretin hormone action. Cell Metab. 2018;27(4):740–756. https://pubmed.ncbi.nlm.nih.gov/29551581/
- Thomas MK, et al. Dual incretin receptor agonists in metabolic research. Diabetes Obes Metab. 2020;22(12):2368–2378. https://pubmed.ncbi.nlm.nih.gov/32706522/
- Heise T, et al. Safety, tolerability, and pharmacology of Tirzepatide in humans. Diabetes Care. 2020;43(12):2910–2918. https://pubmed.ncbi.nlm.nih.gov/32978147/
- Samms RJ, et al. Effects of dual GIP/GLP-1 receptor agonism on energy metabolism. Nat Metab. 2020;2(6):556–563. https://pubmed.ncbi.nlm.nih.gov/32694636/
- Urva SR, et al. Pharmacokinetic and pharmacodynamic modeling of Tirzepatide. Diabetes Obes Metab. 2021;23(1):220–227. https://pubmed.ncbi.nlm.nih.gov/32862523/
- Nauck MA, et al. Incretin therapies and metabolic disease mechanisms. Diabetologia. 2021;64(9):1971–1985. https://pubmed.ncbi.nlm.nih.gov/34050724/
-

PERFECTLY CALCULATED
Manufactured in cGMP-compliant facilities.
-

HUB EFFICIENCY
Trustworthy 3-5 business day delivery service.
-

ASSISTANT EXPERTS
Peptide specialists assist continuously.
You may also like
-
SAVE 25%Reconstitution Solution
Regular price $15.00Regular price $15.00 Sale priceUnit price / per$20.0025% -
SAVE 23%Thymalin - Research Grade Peptide
Regular price $70.00Regular price $70.00 Sale priceUnit price / per$92.0023% -
KLOW Blend - GHK-CU + TB-500 + BPC-157 + KPV 10mg
Regular price $200.00Regular price $200.00 Sale priceUnit price / per$261.0023% -
SAVE 26%Oxytocin Acetate
Regular price $42.00Regular price $42.00 Sale priceUnit price / per$57.0026% -
SAVE 23%HGH Fragment 176-191
Regular price $97.00Regular price $97.00 Sale priceUnit price / per$127.0023% -
SAVE 23%HGH 191AA (Somatropin)
Regular price From $55.00Regular price From $55.00 Sale priceUnit price / per$72.0023% -
SAVE 26%BAC Bacteriostatic Water
Regular price From $14.00Regular price From $14.00 Sale priceUnit price / per$19.0026% -
SAVE 23%Lemon Bottle 10mg
Regular price $80.00Regular price $80.00 Sale priceUnit price / per$105.0023% -
SAVE 26%Acetic Acid Water 0.6%
Regular price From $14.00Regular price From $14.00 Sale priceUnit price / per$19.0026% -
SAVE 26%Benzyl Alcohol 0.9%
Regular price From $14.00Regular price From $14.00 Sale priceUnit price / per$19.0026% -
SAVE 26%Sterile Water
Regular price From $14.00Regular price From $14.00 Sale priceUnit price / per$19.0026% -
SAVE 23%Glow BPC-157 + GHK-CU + TB-500
Regular price $139.00Regular price $139.00 Sale priceUnit price / per$181.0023% -
SAVE 30%Cagrilintide + Semaglutide
Regular price From $125.00Regular price From $125.00 Sale priceUnit price / per$181.0030% -
SAVE 23%Survodutide
Regular price $299.00Regular price $299.00 Sale priceUnit price / per$392.0023% -
SAVE 24%Lipo-C with B Vitamins
Regular price $85.00Regular price $85.00 Sale priceUnit price / per$112.0024% -
Cerebrolysin - Premium Research Peptide
Regular price $40.00Regular price $40.00 Sale priceUnit price / per$54.0025% -
SAVE 24%Cagrilintide
Regular price From $100.00Regular price From $100.00 Sale priceUnit price / per$132.0024% -
SAVE 24%Hyaluronic
Regular price $28.00Regular price $28.00 Sale priceUnit price / per$37.0024% -
SAVE 23%Glutathione
Regular price $83.00Regular price $83.00 Sale priceUnit price / per$109.0023% -
SAVE 24%Dermorphin
Regular price $56.00Regular price $56.00 Sale priceUnit price / per$74.0024% -
SAVE 23%Thymalin - Premium Research Peptide
Regular price $70.00Regular price $70.00 Sale priceUnit price / per$92.0023% -
SAVE 23%Sermorelin
Regular price From $70.00Regular price From $70.00 Sale priceUnit price / per$92.0023% -
SAVE 25%Gonadorelin
Regular price $50.00Regular price $50.00 Sale priceUnit price / per$67.0025% -
SAVE 23%SLU-PP-332
Regular price $125.00Regular price $125.00 Sale priceUnit price / per$164.0023% -
SAVE 25%Tirzepatide
Regular price From $50.00Regular price From $50.00 Sale priceUnit price / per$67.0025% -
SAVE 23%Semaglutide
Regular price From $36.00Regular price From $36.00 Sale priceUnit price / per$47.0023% -
SAVE 23%CJC-1295 No DAC & Ipamorelin
Regular price $95.00Regular price $95.00 Sale priceUnit price / per$124.0023% -
SAVE 23%5-Amino-1MQ
Regular price $80.00Regular price $80.00 Sale priceUnit price / per$105.0023% -
SAVE 23%BPC-157 + TB-500 + GHK-Cu
Regular price $155.00Regular price $155.00 Sale priceUnit price / per$202.0023% -
SAVE 23%L-Carnitine
Regular price $97.00Regular price $97.00 Sale priceUnit price / per$127.0023% -
SAVE 23%CJC-1295 (No DAC)
Regular price From $75.00Regular price From $75.00 Sale priceUnit price / per$98.0023% -
SAVE 23%Kisspeptin-10
Regular price From $65.00Regular price From $65.00 Sale priceUnit price / per$85.0023% -
SAVE 23%CJC-1295 with DAC
Regular price $139.00Regular price $139.00 Sale priceUnit price / per$182.0023% -
SAVE 24%KPV Tripeptide
Regular price From $56.00Regular price From $56.00 Sale priceUnit price / per$74.0024% -
Thymosin Alpha-1 - Premium Research Peptide
Regular price From $79.00Regular price From $79.00 Sale priceUnit price / per$104.0024%
Every vial we sell comes from a lab that follows current Good Manufacturing Practices (cGMP). That means each step of production is documented and controlled. Before a batch is released, it’s tested by independent third-party labs for purity, identity, and sterility. Certificates of analysis are available so you can see the exact test results.
Yes. The labs we work with use ISO-certified clean rooms where air quality, equipment, and handling procedures are tightly regulated. Staff are trained to pharmaceutical-grade standards. This ensures the peptides are produced in an environment that minimizes contamination risks.
Peptides in lyophilized (freeze-dried) form are stable at room temperature for transport. Once you receive them, refrigeration is recommended to maintain long-term integrity. We package every order securely to prevent damage and ship promptly, so your vials arrive in optimal condition.
We operate under strict in-house protocols that follow current Good Manufacturing Practices (cGMP). That means our team oversees the entire process from sourcing raw amino acids to the final lyophilized vial. Nothing is outsourced or repackaged. This gives us full control over purity, consistency, and sterility, and it’s why we can stand behind every single vial we ship.
Store them in the refrigerator, away from direct light and heat. If you need to keep them longer, some peptides can be stored frozen. Each vial comes with clear handling instructions so you know the proper conditions for stability.
The strongest proof is transparency. For every peptide, we can provide certificates of analysis, manufacturing documentation, and references to the published scientific research behind it. If you ever have questions, we’ll show you the data rather than ask you to take our word for it.
The difference is transparency. Most sites give you a product name and a price. We provide full batch testing, lab documentation, and direct access to certificates of analysis so you don’t have to guess what you’re getting. When you order from us, you know exactly what’s in the vial, where it was made, and how it was verified.

